View source for PE001682

Jump to navigation Jump to search

You do not have permission to edit this page, for the following reason:

The action you have requested is limited to users in the group: Users.

You can view and copy the source of this page.

{{Peptide
|glycan=G25987BV;N16
|mw=5450.498
|name=R.IFKEAEKFFVSVGLPN{{!(}}H3N4F{{!)}}MTQGFWENSMLTDPGNVQK.A
|nox=0
|nrt=129.259
|nrtobs=1
|sequence=IFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQK
}}{{Alignment
|end=341
|laa=R
|protein=Q9BYF1
|prsites=N322
|raa=A
|site=Q9BYF1@N322
|start=307
}}

Templates used on this page:

Return to PE001682.

Retrieved from "https://gptwiki.glyomics.org/gptwiki/PE001682"