PE001656

From GPTWiki
Revision as of 17:32, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G73686WG;N29 |mod=+57.021;C37 |mw=7359.236 |name=K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN{{!(}}H7N6FS{{!)}}FTTAPAICHDGK.A |nox=0 |nrt=69.303 |nrtobs=1 |sequence=GYHLM...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6FS]FTTAPAICHDGK.A
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H7N6FS (N29)
Mod(s) 57.021 (C37)
Molecular Weight 7359.236
Norm. RT 69.303
Protein S (P0DTC2)

Samples

SARS-CoV-2 Spike Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00434942.08240.4771,224.5476OrbitrapSARS-CoV-2 Spike Protein4
TG00436342.34241.70969.3031,469.2555OrbitrapSARS-CoV-2 Spike Protein8
TG00434242.08240.46566.6111,049.7567OrbitrapSARS-CoV-2 Spike Protein6
TG00433442.08241.51769.2571,469.2555OrbitrapSARS-CoV-2 Spike Protein8
TG00435442.3421,224.5476OrbitrapSARS-CoV-2 Spike Protein7
TG00436942.34241.32768.3521,049.7567OrbitrapSARS-CoV-2 Spike Protein6