Difference between revisions of "PE001656"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{Peptide |glycan=G73686WG;N29 |mod=+57.021;C37 |mw=7359.236 |name=K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN{{!(}}H7N6FS{{!)}}FTTAPAICHDGK.A |nox=0 |nrt=69.303 |nrtobs=1 |sequence=GYHLM...")
 
 
(One intermediate revision by the same user not shown)
Line 5: Line 5:
 
|name=K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN{{!(}}H7N6FS{{!)}}FTTAPAICHDGK.A
 
|name=K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN{{!(}}H7N6FS{{!)}}FTTAPAICHDGK.A
 
|nox=0
 
|nox=0
|nrt=69.303
+
|nrt=69.280
|nrtobs=1
+
|nrtobs=2
 
|sequence=GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
 
|sequence=GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
 
}}{{Alignment
 
}}{{Alignment
Line 14: Line 14:
 
|prsites=N1074
 
|prsites=N1074
 
|raa=A
 
|raa=A
 +
|site=P0DTC2@N1074
 
|start=1046
 
|start=1046
 
}}
 
}}

Latest revision as of 21:43, 26 May 2021

Name K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6FS]FTTAPAICHDGK.A
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H7N6FS (N29)
Mod(s) 57.021 (C37)
Molecular Weight 7359.236
Norm. RT 69.280
Protein S (P0DTC2)

Samples

SARS-CoV-2 Spike Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00433442.08241.51769.2571,469.2555OrbitrapSARS-CoV-2 Spike Protein8
TG00435442.3421,224.5476OrbitrapSARS-CoV-2 Spike Protein7
TG00436942.34241.32768.3521,049.7567OrbitrapSARS-CoV-2 Spike Protein6
TG00434942.08240.4771,224.5476OrbitrapSARS-CoV-2 Spike Protein4
TG00436342.34241.70969.3031,469.2555OrbitrapSARS-CoV-2 Spike Protein8
TG00434242.08240.46566.6111,049.7567OrbitrapSARS-CoV-2 Spike Protein6