Difference between revisions of "PE001656"

From GPTWiki
Jump to navigation Jump to search
 
Line 14: Line 14:
 
|prsites=N1074
 
|prsites=N1074
 
|raa=A
 
|raa=A
 +
|site=P0DTC2@N1074
 
|start=1046
 
|start=1046
 
}}
 
}}

Latest revision as of 21:43, 26 May 2021

Name K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6FS]FTTAPAICHDGK.A
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H7N6FS (N29)
Mod(s) 57.021 (C37)
Molecular Weight 7359.236
Norm. RT 69.280
Protein S (P0DTC2)

Samples

SARS-CoV-2 Spike Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00434942.08240.4771,224.5476OrbitrapSARS-CoV-2 Spike Protein4
TG00436342.34241.70969.3031,469.2555OrbitrapSARS-CoV-2 Spike Protein8
TG00434242.08240.46566.6111,049.7567OrbitrapSARS-CoV-2 Spike Protein6
TG00433442.08241.51769.2571,469.2555OrbitrapSARS-CoV-2 Spike Protein8
TG00435442.3421,224.5476OrbitrapSARS-CoV-2 Spike Protein7
TG00436942.34241.32768.3521,049.7567OrbitrapSARS-CoV-2 Spike Protein6