Difference between revisions of "PE001618"

From GPTWiki
Jump to navigation Jump to search
 
Line 12: Line 12:
 
|prsites=N1074
 
|prsites=N1074
 
|raa=A
 
|raa=A
 +
|site=P0DTC2@N1074
 
|start=1046
 
|start=1046
 
}}
 
}}

Latest revision as of 21:41, 26 May 2021

Name K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N5FS]FTTAPAICHDGK.A
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H6N5FS (N29)
Mod(s) 57.021 (C37)
Molecular Weight 6994.103
Norm. RT
Protein S (P0DTC2)

Samples

SARS-CoV-2 Spike Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00420542.91341.64769.1481,163.6926OrbitrapSARS-CoV-2 Spike Protein10
TG00663141.72140.98367.9141,396.2295OrbitrapSARS-CoV-2 Spike Protein6