PE001557

From GPTWiki
Revision as of 07:57, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G98596OT;N29 |mod=+57.021;C37 |mw=7488.278 |name=K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN{{!(}}H6N6FS2{{!)}}FTTAPAICHDGK.A |nox=0 |sequence=GYHLMSFPQSAPHGVVFLHVTYVPAQ...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N6FS2]FTTAPAICHDGK.A
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H6N6FS2 (N29)
Mod(s) 57.021 (C37)
Molecular Weight 7488.278
Norm. RT
Protein S (P0DTC2)

Samples

SARS-CoV-2 Spike Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00408143.58243.61974.5441,068.1917OrbitrapSARS-CoV-2 Spike Protein16
TG00426444.00043.96974.9271,068.1917OrbitrapSARS-CoV-2 Spike Protein18