PE001552

From GPTWiki
Revision as of 20:32, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G80735OA;N29 |mod=+57.021;C37 |mw=6906.087 |name=K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN{{!(}}H6N6F{{!)}}FTTAPAICHDGK.A |nox=0 |nrt=62.624 |nrtobs=1 |sequence=GYHLMS...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N6F]FTTAPAICHDGK.A
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H6N6F (N29)
Mod(s) 57.021 (C37)
Molecular Weight 6906.087
Norm. RT 62.624
Protein S (P0DTC2)

Samples

SARS-CoV-2 Spike Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00417739.306985.0217OrbitrapSARS-CoV-2 Spike Protein6
TG00406339.30638.88062.6241,149.0236OrbitrapSARS-CoV-2 Spike Protein5