Difference between revisions of "PE001551"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{Peptide |glycan=G69364JQ;N29 |mod=+57.021;C37 |mw=6744.034 |name=K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN{{!(}}H5N6F{{!)}}FTTAPAICHDGK.A |nox=0 |nrt=62.680 |nrtobs=2 |sequence=GYHLMS...")
Line 14: Line 14:

Latest revision as of 21:38, 26 May 2021

Glycans(s) H5N6F (N29)
Mod(s) 57.021 (C37)
Molecular Weight 6744.034
Norm. RT 62.680
Protein S (P0DTC2)


SARS-CoV-2 Spike Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00409738.31938.69662.161961.8707OrbitrapSARS-CoV-2 Spike Protein9
TG00428139.35539.25663.198961.8707OrbitrapSARS-CoV-2 Spike Protein10