Difference between revisions of "PE001546"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{Peptide |glycan=G41044JW;N29 |mod=+57.021;C37 |mw=7941.426 |name=K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN{{!(}}H7N6FS3{{!)}}FTTAPAICHDGK.A |nox=0 |sequence=GYHLMSFPQSAPHGVVFLHVTYVPAQ...")
 
 
Line 12: Line 12:
 
|prsites=N1074
 
|prsites=N1074
 
|raa=A
 
|raa=A
 +
|site=P0DTC2@N1074
 
|start=1046
 
|start=1046
 
}}
 
}}

Latest revision as of 21:38, 26 May 2021

Name K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6FS3]FTTAPAICHDGK.A
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H7N6FS3 (N29)
Mod(s) 57.021 (C37)
Molecular Weight 7941.426
Norm. RT
Protein S (P0DTC2)

Samples

SARS-CoV-2 Spike Protein

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00416946.62246.62982.1151,132.9267OrbitrapSARS-CoV-2 Spike Protein7