PE001380

From GPTWiki
Revision as of 20:05, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G00912UN;N33 |mod=+57.021;C22 |mw=5838.524 |name=K.IMNGEADAMSLDGGFVYIAGKCGLVPVLAENYN{{!(}}H5N4S2{{!)}}K.S |nox=0 |nrt=135.702 |nrtobs=1 |sequence=IMNGEADAMSL...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.IMNGEADAMSLDGGFVYIAGKCGLVPVLAENYN[H5N4S2]K.S
Sequence IMNGEADAMSLDGGFVYIAGKCGLVPVLAENYNK
Glycans(s) H5N4S2 (N33)
Mod(s) 57.021 (C22)
Molecular Weight 5838.524
Norm. RT 135.702
Protein TF (P02787)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00335167.33367.036135.7021,456.1394OrbitrapHuman Serum5