PE001285

From GPTWiki
Revision as of 02:44, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G60923RB;N17 |mw=6558.255 |name=R.TEVSSNHVLIYLDKVSN{{!(}}H5N4F2{{!)}}QTLSLFFTVLQDVPVRDLKPAIVK.V |nox=0 |sequence=TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVK }}...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name R.TEVSSNHVLIYLDKVSN[H5N4F2]QTLSLFFTVLQDVPVRDLKPAIVK.V
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVK
Glycans(s) H5N4F2 (N17)
Mod(s)
Molecular Weight 6558.255
Norm. RT
Protein A2M (P01023)

Samples

DDA Transition Groups