Difference between revisions of "PE001285"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{Peptide |glycan=G60923RB;N17 |mw=6558.255 |name=R.TEVSSNHVLIYLDKVSN{{!(}}H5N4F2{{!)}}QTLSLFFTVLQDVPVRDLKPAIVK.V |nox=0 |sequence=TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVK }}...")
Line 11: Line 11:

Latest revision as of 20:23, 26 May 2021

Glycans(s) H5N4F2 (N17)
Molecular Weight 6558.255
Norm. RT
Protein A2M (P01023)


DDA Transition Groups