PE001283

From GPTWiki
Revision as of 21:23, 26 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name R.SNHVSRTEVSSNHVLIYLDKVSN[H5N4FS]QTLSLFFTVLQDVPVR.D
Sequence SNHVSRTEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVR
Glycans(s) H5N4FS (N23)
Mod(s)
Molecular Weight 6519.085
Norm. RT 171.856
Protein A2M (P01023)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00295782.11281.784171.8561,084.5206OrbitrapHuman Serum7