Difference between revisions of "PE001283"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{Peptide |glycan=G08293MJ;N23 |mw=6519.085 |name=R.SNHVSRTEVSSNHVLIYLDKVSN{{!(}}H5N4FS{{!)}}QTLSLFFTVLQDVPVR.D |nox=0 |nrt=171.856 |nrtobs=1 |sequence=SNHVSRTEVSSNHVLIYLDKVSN...")
 
 
Line 13: Line 13:
 
|prsites=N1424
 
|prsites=N1424
 
|raa=D
 
|raa=D
 +
|site=P01023@N1424
 
|start=1402
 
|start=1402
 
}}
 
}}

Latest revision as of 21:23, 26 May 2021

Name R.SNHVSRTEVSSNHVLIYLDKVSN[H5N4FS]QTLSLFFTVLQDVPVR.D
Sequence SNHVSRTEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVR
Glycans(s) H5N4FS (N23)
Mod(s)
Molecular Weight 6519.085
Norm. RT 171.856
Protein A2M (P01023)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00295782.11281.784171.8561,084.5206OrbitrapHuman Serum7