PE001247

From GPTWiki
Revision as of 21:21, 26 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.YTGN[H5N4S2]ASALFILPDQDKMEEVEAMLLPETLKR.W
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLKR
Glycans(s) H5N4S2 (N4)
Mod(s)
Molecular Weight 5744.562
Norm. RT
Protein SERPINA3 (P01011)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00285772.25869.637146.0001,432.6464OrbitrapHuman Serum5