Difference between revisions of "PE001247"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{Peptide |glycan=G00912UN;N4 |mw=5744.562 |name=K.YTGN{{!(}}H5N4S2{{!)}}ASALFILPDQDKMEEVEAMLLPETLKR.W |nox=0 |sequence=YTGNASALFILPDQDKMEEVEAMLLPETLKR }}{{Alignment |end=298...")
 
 
Line 11: Line 11:
 
|prsites=N271
 
|prsites=N271
 
|raa=W
 
|raa=W
 +
|site=P01011@N271
 
|start=268
 
|start=268
 
}}
 
}}

Latest revision as of 21:21, 26 May 2021

Name K.YTGN[H5N4S2]ASALFILPDQDKMEEVEAMLLPETLKR.W
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLKR
Glycans(s) H5N4S2 (N4)
Mod(s)
Molecular Weight 5744.562
Norm. RT
Protein SERPINA3 (P01011)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00285772.25869.637146.0001,432.6464OrbitrapHuman Serum5