PE001246

From GPTWiki
Revision as of 01:11, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G15038BD;N4 |mw=5779.628 |name=K.YLGN{{!(}}H6N4FS{{!)}}ATAIFFLPDEGKLQHLENELTHDIITK.F |nox=0 |sequence=YLGNATAIFFLPDEGKLQHLENELTHDIITK }}{{Alignment |end=298...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.YLGN[H6N4FS]ATAIFFLPDEGKLQHLENELTHDIITK.F
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H6N4FS (N4)
Mod(s)
Molecular Weight 5779.628
Norm. RT
Protein SERPINA1 (P01009)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00285869.63469.751146.2891,153.3315OrbitrapHuman Serum5