PE001243

From GPTWiki
Revision as of 21:21, 26 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name R.VNQNLVYESGSLN[H5N4S2]FSKLEIQSQVDSQHVGHSVLTAK.G
Sequence VNQNLVYESGSLNFSKLEIQSQVDSQHVGHSVLTAK
Glycans(s) H5N4S2 (N13)
Mod(s)
Molecular Weight 6177.791
Norm. RT 90.289
Protein APOB (P04114)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00286044.90947.66090.2891,232.9645OrbitrapHuman Serum15

DIA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleIntensity
TG00811838.36038.36090.7731,232.9645TripleTOFHuman Serum18,486.6