PE001225

From GPTWiki
Revision as of 20:20, 26 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N3S]GSLFAFR.G
Sequence GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFR
Glycans(s) H5N3S (N62)
Mod(s) 57.021 (C49)
Molecular Weight 9193.272
Norm. RT 72.032
Protein VTN (P04004)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00284541.36241.46572.0321,147.9178OrbitrapHuman Serum6