PE001223

From GPTWiki
Revision as of 21:20, 26 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.GGETAQSADPQWEQLNNKN[H6N5S3]LSMPLLPADFHK.E
Sequence GGETAQSADPQWEQLNNKNLSMPLLPADFHK
Glycans(s) H6N5S3 (N19)
Mod(s)
Molecular Weight 6314.662
Norm. RT 101.351
Protein SERPIND1 (P05546)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00283752.82452.706101.3511,575.1714OrbitrapHuman Serum13