PE001186

From GPTWiki
Revision as of 21:18, 26 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.SSVITLNTNAELFN[H9N2]QSDIVAHLLSSSSSVIDALQYK.L
Sequence SSVITLNTNAELFNQSDIVAHLLSSSSSVIDALQYK
Glycans(s) H9N2 (N14)
Mod(s)
Molecular Weight 5746.624
Norm. RT 158.132
Protein APOB (P04114)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00279374.06774.532158.1321,433.1614OrbitrapHuman Serum14

DIA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleIntensity
TG00644478.53678.536163.7681,433.1614OrbitrapHuman Serum651,377
TG00907357.29957.299182.7951,433.1614TripleTOFHuman Serum267,945
TG00816056.93156.931171.6641,433.1614TripleTOFHuman Serum222,606
TG00876559.78459.784195.9161,433.1614TripleTOFHuman Serum132,225
TG00846759.26459.264196.7361,433.1614TripleTOFHuman Serum100,136
TG01018656.73356.733177.0181,433.1614TripleTOFHuman Serum84,376.7
TG00974556.59856.598181.7051,433.1614TripleTOFHuman Serum72,229.1
TG01059559.06159.061187.7671,433.1614TripleTOFHuman Serum54,241.3