Difference between revisions of "PE001185"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{Peptide |glycan=G00912UN;N7 |mw=5403.411 |name=R.QLAHQSN{{!(}}H5N4S2{{!)}}STNIFFSPVSIATAFAMLSLGTK.A |nox=0 |sequence=QLAHQSNSTNIFFSPVSIATAFAMLSLGTK }}{{Alignment |end=93 |la...")
 
 
Line 11: Line 11:
 
|prsites=N70
 
|prsites=N70
 
|raa=A
 
|raa=A
 +
|site=P01009@N70
 
|start=64
 
|start=64
 
}}
 
}}

Latest revision as of 21:18, 26 May 2021

Name R.QLAHQSN[H5N4S2]STNIFFSPVSIATAFAMLSLGTK.A
Sequence QLAHQSNSTNIFFSPVSIATAFAMLSLGTK
Glycans(s) H5N4S2 (N7)
Mod(s)
Molecular Weight 5403.411
Norm. RT
Protein SERPINA1 (P01009)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00279490.0131,347.3584OrbitrapHuman Serum7