View source for PE001179

Jump to navigation Jump to search

You do not have permission to edit this page, for the following reason:

The action you have requested is limited to users in the group: Users.

You can view and copy the source of this page.

{{Peptide
|glycan=G06247RL;N5
|mw=7516.274
|name=R.NQALN{{!(}}H6N5S3{{!)}}LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N
|nox=0
|nrt=156.268
|nrtobs=4
|sequence=NQALNLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR
}}{{Alignment
|end=614
|laa=R
|protein=Q14624
|prsites=N577
|raa=N
|site=Q14624@N577
|start=573
}}

Templates used on this page:

Return to PE001179.

Retrieved from "https://gptwiki.glyomics.org/gptwiki/PE001179"