PE001166

From GPTWiki
Revision as of 21:17, 26 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.CGLVPVLAENYN[H6N6F]KSDNCEDTPEAGYFAIAVVK.K
Sequence CGLVPVLAENYNKSDNCEDTPEAGYFAIAVVK
Glycans(s) H6N6F (N12)
Mod(s) 57.021 (C1), 57.021 (C17)
Molecular Weight 5897.531
Norm. RT 112.510
Protein TF (P02787)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00263356.60456.653112.5101,176.9175OrbitrapHuman Serum7