PE001041

From GPTWiki
Revision as of 21:11, 26 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name R.TEVSSNHVLIYLDKVSN[H7N6]QTLSLFFTVLQDVPVR.D
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVR
Glycans(s) H7N6 (N17)
Mod(s)
Molecular Weight 6131.861
Norm. RT
Protein A2M (P01023)

Samples

DDA Transition Groups