View source for PE001041

Jump to navigation Jump to search

You do not have permission to edit this page, for the following reason:

The action you have requested is limited to users in the group: Users.

You can view and copy the source of this page.

{{Peptide
|glycan=G43669FQ;N17
|mw=6131.861
|name=R.TEVSSNHVLIYLDKVSN{{!(}}H7N6{{!)}}QTLSLFFTVLQDVPVR.D
|nox=0
|sequence=TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVR
}}{{Alignment
|end=1440
|laa=R
|protein=P01023
|prsites=N1424
|raa=D
|site=P01023@N1424
|start=1408
}}

Templates used on this page:

Return to PE001041.

Retrieved from "https://gptwiki.glyomics.org/gptwiki/PE001041"