PE000782

From GPTWiki
Revision as of 15:23, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G01650EU;N6 |mod=+57.021;C20 |mw=5431.377 |name=K.SLGNVN{{!(}}H6N3S{{!)}}FTVSAEALESQELCGTEVPSVPEHGRK.D |nox=0 |nrt=74.856 |nrtobs=1 |sequence=SLGNVNFTVSAEALE...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.SLGNVN[H6N3S]FTVSAEALESQELCGTEVPSVPEHGRK.D
Sequence SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK
Glycans(s) H6N3S (N6)
Mod(s) 57.021 (C20)
Molecular Weight 5431.377
Norm. RT 74.856
Protein A2M (P01023)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00177339.03039.0651,354.3524OrbitrapHuman Serum10