PE000661

From GPTWiki
Revision as of 20:53, 26 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name R.YTCEEPYYYMENGGGGEYHCAGN[H5N4S2]GSWVNEVLGPELPK.C
Sequence YTCEEPYYYMENGGGGEYHCAGNGSWVNEVLGPELPK
Glycans(s) H5N4S2 (N23)
Mod(s) 57.021 (C3), 57.021 (C20)
Molecular Weight 6448.560
Norm. RT 115.996
Protein C1S (P09871)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00137258.31858.406115.9961,608.6514OrbitrapHuman Serum5