PE000628

From GPTWiki
Revision as of 18:46, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G06247RL;N28 |mod=+57.021;C31 |mw=6870.781 |name=R.REGDHEFLEVPEAQEDVEATFPVHQPGN{{!(}}H6N5S3{{!)}}YSCSYR.T |nox=0 |sequence=REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H6N5S3]YSCSYR.T
Sequence REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H6N5S3 (N28)
Mod(s) 57.021 (C31)
Molecular Weight 6870.781
Norm. RT
Protein A1BG (P04217)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00129645.90545.71683.5141,371.5655OrbitrapHuman Serum13