Difference between revisions of "PE000628"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{Peptide |glycan=G06247RL;N28 |mod=+57.021;C31 |mw=6870.781 |name=R.REGDHEFLEVPEAQEDVEATFPVHQPGN{{!(}}H6N5S3{{!)}}YSCSYR.T |nox=0 |sequence=REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR...")
 
 
Line 12: Line 12:
 
|prsites=N179
 
|prsites=N179
 
|raa=T
 
|raa=T
 +
|site=P04217@N179
 
|start=152
 
|start=152
 
}}
 
}}

Latest revision as of 20:51, 26 May 2021

Name R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H6N5S3]YSCSYR.T
Sequence REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H6N5S3 (N28)
Mod(s) 57.021 (C31)
Molecular Weight 6870.781
Norm. RT
Protein A1BG (P04217)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00129645.90545.71683.5141,371.5655OrbitrapHuman Serum13