PE000538

From GPTWiki
Revision as of 19:47, 26 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S]YSCSYR.T
Sequence REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S (N28)
Mod(s) 57.021 (C31)
Molecular Weight 5923.458
Norm. RT 66.553
Protein A1BG (P04217)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00134938.91738.85666.5531,182.1005OrbitrapHuman Serum11
TG00104238.39040.31570.6161,182.1005OrbitrapHuman Serum8
TG00318241.06440.84867.7351,182.1005OrbitrapHuman Serum9