PE000535

From GPTWiki
Revision as of 20:47, 26 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name R.NQALN[H5N4S]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N
Sequence NQALNLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR
Glycans(s) H5N4S (N5)
Mod(s)
Molecular Weight 6568.951
Norm. RT
Protein ITIH4 (Q14624)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00113062.1691,311.1965OrbitrapHuman Serum15