PE000440

From GPTWiki
Revision as of 22:04, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G94917XT;N5 |mw=7662.331 |name=R.NQALN{{!(}}H6N5FS3{{!)}}LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N |nox=0 |nrt=155.270 |nrtobs=1 |sequence=NQALNLSLAYSFVTPLTSMV...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name R.NQALN[H6N5FS3]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N
Sequence NQALNLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR
Glycans(s) H6N5FS3 (N5)
Mod(s)
Molecular Weight 7662.331
Norm. RT 155.270
Protein ITIH4 (Q14624)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00080074.14673.798155.2701,529.8725OrbitrapHuman Serum9