Difference between revisions of "PE000440"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{Peptide |glycan=G94917XT;N5 |mw=7662.331 |name=R.NQALN{{!(}}H6N5FS3{{!)}}LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N |nox=0 |nrt=155.270 |nrtobs=1 |sequence=NQALNLSLAYSFVTPLTSMV...")
 
 
Line 13: Line 13:
 
|prsites=N577
 
|prsites=N577
 
|raa=N
 
|raa=N
 +
|site=Q14624@N577
 
|start=573
 
|start=573
 
}}
 
}}

Latest revision as of 20:42, 26 May 2021

Name R.NQALN[H6N5FS3]LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR.N
Sequence NQALNLSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPMEGESR
Glycans(s) H6N5FS3 (N5)
Mod(s)
Molecular Weight 7662.331
Norm. RT 155.270
Protein ITIH4 (Q14624)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00080074.14673.798155.2701,529.8725OrbitrapHuman Serum9