
From GPTWiki
Revision as of 05:51, 7 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G00912UN;N5 |mod=+15.995;M37 |mw=6876.041 |name=R.NQALN{{!(}}H5N4S2{{!)}}LSLAYSFVTPLTSMVVTKPDDQEQSQVAEKPM{{!(}}Ox{{!)}}EGESR.N |nox=1 |sequence=NQALNLSLAYSFV...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Glycans(s) H5N4S2 (N5)
Mod(s) 15.995 (M37)
Molecular Weight 6876.041
Norm. RT
Protein ITIH4 (Q14624)


Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00351968.39968.380138.8051,372.6145OrbitrapHuman Serum7
TG00085666.82867.052138.2231,372.6145OrbitrapHuman Serum11
TG00039566.53567.380140.0931,372.6145OrbitrapHuman Serum9