PE000346

From GPTWiki
Revision as of 23:48, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G10486CT;N4 |mw=5180.422 |name=K.YLGN{{!(}}H5N4{{!)}}ATAIFFLPDEGKLQHLENELTHDIITK.F |nox=0 |sequence=YLGNATAIFFLPDEGKLQHLENELTHDIITK }}{{Alignment |end=298 |l...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.YLGN[H5N4]ATAIFFLPDEGKLQHLENELTHDIITK.F
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4 (N4)
Mod(s)
Molecular Weight 5180.422
Norm. RT
Protein SERPINA1 (P01009)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00116060.5701,033.4905OrbitrapHuman Serum8