Difference between revisions of "PE000346"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{Peptide |glycan=G10486CT;N4 |mw=5180.422 |name=K.YLGN{{!(}}H5N4{{!)}}ATAIFFLPDEGKLQHLENELTHDIITK.F |nox=0 |sequence=YLGNATAIFFLPDEGKLQHLENELTHDIITK }}{{Alignment |end=298 |l...")
 
 
Line 11: Line 11:
 
|prsites=N271
 
|prsites=N271
 
|raa=F
 
|raa=F
 +
|site=P01009@N271
 
|start=268
 
|start=268
 
}}
 
}}

Latest revision as of 20:37, 26 May 2021

Name K.YLGN[H5N4]ATAIFFLPDEGKLQHLENELTHDIITK.F
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4 (N4)
Mod(s)
Molecular Weight 5180.422
Norm. RT
Protein SERPINA1 (P01009)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00116060.5701,033.4905OrbitrapHuman Serum8