PE000284

From GPTWiki
Revision as of 20:34, 26 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name R.EGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4]YSCSYR.T
Sequence EGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4 (N27)
Mod(s) 57.021 (C30)
Molecular Weight 5476.262
Norm. RT
Protein A1BG (P04217)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00314041.39541.38269.1171,365.5744OrbitrapHuman Serum4