PE000268

From GPTWiki
Revision as of 21:53, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G00912UN;N17 |mw=6848.330 |name=R.TEVSSNHVLIYLDKVSN{{!(}}H5N4S2{{!)}}QTLSLFFTVLQDVPVRDLKPAIVK.V |nox=0 |nrt=188.778 |nrtobs=1 |sequence=TEVSSNHVLIYLDKVSNQTLS...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name R.TEVSSNHVLIYLDKVSN[H5N4S2]QTLSLFFTVLQDVPVRDLKPAIVK.V
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVK
Glycans(s) H5N4S2 (N17)
Mod(s)
Molecular Weight 6848.330
Norm. RT 188.778
Protein A2M (P01023)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00029981.42281.3941,139.3946OrbitrapHuman Serum13
TG00295289.5111,367.0725OrbitrapHuman Serum8