PE000262

From GPTWiki
Revision as of 20:02, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G00912UN;N17 |mw=5983.787 |name=R.TEVSSNHVLIYLDKVSN{{!(}}H5N4S2{{!)}}QTLSLFFTVLQDVPVR.D |nox=0 |sequence=TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVR }}{{Alignment |end...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name R.TEVSSNHVLIYLDKVSN[H5N4S2]QTLSLFFTVLQDVPVR.D
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVR
Glycans(s) H5N4S2 (N17)
Mod(s)
Molecular Weight 5983.787
Norm. RT
Protein A2M (P01023)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00030789.2511,492.4524OrbitrapHuman Serum8