Difference between revisions of "PE000262"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{Peptide |glycan=G00912UN;N17 |mw=5983.787 |name=R.TEVSSNHVLIYLDKVSN{{!(}}H5N4S2{{!)}}QTLSLFFTVLQDVPVR.D |nox=0 |sequence=TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVR }}{{Alignment |end...")
 
 
Line 11: Line 11:
 
|prsites=N1424
 
|prsites=N1424
 
|raa=D
 
|raa=D
 +
|site=P01023@N1424
 
|start=1408
 
|start=1408
 
}}
 
}}

Latest revision as of 20:33, 26 May 2021

Name R.TEVSSNHVLIYLDKVSN[H5N4S2]QTLSLFFTVLQDVPVR.D
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVR
Glycans(s) H5N4S2 (N17)
Mod(s)
Molecular Weight 5983.787
Norm. RT
Protein A2M (P01023)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00030789.2511,492.4524OrbitrapHuman Serum8