PE000254

From GPTWiki
Revision as of 20:32, 26 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.YLGN[H5N4FS2]ATAIFFLPDEGKLQHLENELTHDIITK.F
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4FS2 (N4)
Mod(s)
Molecular Weight 5908.671
Norm. RT 146.480
Protein SERPINA1 (P01009)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00516170.33970.764147.1711,179.1405OrbitrapHuman Serum11
TG00544185.58985.307134.8291,179.1405OrbitrapHuman Serum19
TG00268869.52069.740146.2611,473.6734OrbitrapHuman Serum12
TG00074570.30370.070146.6981,179.1405OrbitrapHuman Serum13
TG00035565.88865.8271,179.1405OrbitrapHuman Serum9
TG00267469.52069.696146.1491,179.1405OrbitrapHuman Serum10
TG00522283.93783.638131.1041,179.1405OrbitrapHuman Serum17