PE000250

From GPTWiki
Revision as of 20:32, 26 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name R.TEVSSNHVLIYLDKVSN[H5N4FS]QTLSLFFTVLQDVPVRDLKPAIVK.V
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVK
Glycans(s) H5N4FS (N17)
Mod(s)
Molecular Weight 6703.293
Norm. RT 181.064
Protein A2M (P01023)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00024976.5661,115.2226OrbitrapHuman Serum18
TG00294086.21985.350181.0821,338.0645OrbitrapHuman Serum6
TG00014876.56676.3501,338.0645OrbitrapHuman Serum11
TG00292486.21985.336181.0461,115.2226OrbitrapHuman Serum14
TG00031376.56676.335956.0487OrbitrapHuman Serum19