PE000245

From GPTWiki
Revision as of 20:32, 26 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name R.TEVSSNHVLIYLDKVSN[H5N4S]QTLSLFFTVLQDVPVRDLKPAIVK.V
Sequence TEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVK
Glycans(s) H5N4S (N17)
Mod(s)
Molecular Weight 6557.235
Norm. RT 181.680
Protein A2M (P01023)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00037276.7381,090.8796OrbitrapHuman Serum11
TG00293985.40285.581181.6801,308.8535OrbitrapHuman Serum12
TG00293785.4021,090.8796OrbitrapHuman Serum13
TG00015776.73876.5851,308.8535OrbitrapHuman Serum13