Difference between revisions of "PE000232"

From GPTWiki
Jump to navigation Jump to search
 
Line 14: Line 14:
 
|prsites=N869
 
|prsites=N869
 
|raa=D
 
|raa=D
 +
|site=P01023@N869
 
|start=864
 
|start=864
 
}}
 
}}

Latest revision as of 20:31, 26 May 2021

Name K.SLGNVN[H5N4S]FTVSAEALESQELCGTEVPSVPEHGRK.D
Sequence SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK
Glycans(s) H5N4S (N6)
Mod(s) 57.021 (C20)
Molecular Weight 5472.403
Norm. RT 73.340
Protein A2M (P01023)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00031938.92738.9691,364.6094OrbitrapHuman Serum7
TG00529459.67359.54273.3401,364.6094OrbitrapHuman Serum7