Difference between revisions of "PE000232"

From GPTWiki
Jump to navigation Jump to search
(Created page with "{{Peptide |glycan=G59626AS;N6 |mod=+57.021;C20 |mw=5472.403 |name=K.SLGNVN{{!(}}H5N4S{{!)}}FTVSAEALESQELCGTEVPSVPEHGRK.D |nox=0 |nrt=73.969 |nrtobs=2 |sequence=SLGNVNFTVSAEALE...")
 
Line 5: Line 5:
 
|name=K.SLGNVN{{!(}}H5N4S{{!)}}FTVSAEALESQELCGTEVPSVPEHGRK.D
 
|name=K.SLGNVN{{!(}}H5N4S{{!)}}FTVSAEALESQELCGTEVPSVPEHGRK.D
 
|nox=0
 
|nox=0
|nrt=73.969
+
|nrt=73.340
|nrtobs=2
+
|nrtobs=1
 
|sequence=SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK
 
|sequence=SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK
 
}}{{Alignment
 
}}{{Alignment

Revision as of 19:20, 14 May 2021

Name K.SLGNVN[H5N4S]FTVSAEALESQELCGTEVPSVPEHGRK.D
Sequence SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK
Glycans(s) H5N4S (N6)
Mod(s) 57.021 (C20)
Molecular Weight 5472.403
Norm. RT 73.340
Protein A2M (P01023)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00529459.67359.54273.3401,364.6094OrbitrapHuman Serum7
TG00031938.92738.9691,364.6094OrbitrapHuman Serum7