PE000225

From GPTWiki
Revision as of 20:31, 26 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKN[H5N4S]GSLFAFR.G
Sequence GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFR
Glycans(s) H5N4S (N62)
Mod(s) 57.021 (C49)
Molecular Weight 9396.351
Norm. RT 74.531
Protein VTN (P04004)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00112541.67341.82674.5421,173.3028OrbitrapHuman Serum9
TG00113641.67341.81874.5211,340.7737OrbitrapHuman Serum8
TG00026536.89936.9731,173.3028OrbitrapHuman Serum6