
From GPTWiki
Revision as of 16:17, 6 April 2021 by Edwardsnj (talk | contribs) (Created page with "{{Peptide |glycan=G59626AS;N62 |mod=+57.021;C49 |mw=9396.351 |name=K.GNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKN{{!(}}H5N4S{{!)}}GSLFAFR.G |nox=0 |nrt=74.52...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Glycans(s) H5N4S (N62)
Mod(s) 57.021 (C49)
Molecular Weight 9396.351
Norm. RT 74.521
Protein VTN (P04004)


Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00112541.67341.82674.5421,173.3028OrbitrapHuman Serum9
TG00113641.67341.81874.5211,340.7737OrbitrapHuman Serum8
TG00026536.89936.9731,173.3028OrbitrapHuman Serum6