PE000220

From GPTWiki
Revision as of 20:30, 26 May 2021 by Edwardsnj (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search
Name K.YLGN[H5N4S]ATAIFFLPDEGKLQHLENELTHDIITK.F
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4S (N4)
Mod(s)
Molecular Weight 5471.518
Norm. RT 134.887
Protein SERPINA1 (P01009)

Samples

Human Serum

DDA Transition Groups

 Exp. R.T.Peak R.T.Norm. R.T.Prec. m/zPrec. zInst.SampleTransitions
TG00076165.30565.610135.3741,364.3854OrbitrapHuman Serum8
TG00078865.30565.365134.7521,091.7095OrbitrapHuman Serum10
TG00543778.34578.355118.3241,091.7095OrbitrapHuman Serum11
TG00101064.76265.054134.8951,091.7095OrbitrapHuman Serum8
TG00106564.76265.048134.8801,364.3854OrbitrapHuman Serum8