View source for PE000146

Jump to navigation Jump to search

You do not have permission to edit this page, for the following reason:

The action you have requested is limited to users in the group: Users.

You can view and copy the source of this page.

{{Peptide
|glycan=G59626AS;N4
|mod=+15.995;M23
|mw=5266.265
|name=N.YYSN{{!(}}H5N4S{{!)}}ATTDEHGLVQFSINTTNVM{{!(}}Ox{{!)}}GTSLTVR.V
|nox=1
|sequence=YYSNATTDEHGLVQFSINTTNVMGTSLTVR
}}{{Alignment
|end=422
|laa=N
|protein=P01023
|prsites=N396
|raa=V
|site=P01023@N396
|start=393
}}

Templates used on this page:

Return to PE000146.

Retrieved from "https://gptwiki.glyomics.org/gptwiki/PE000146"